Tesamorelin comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-06-02. Where a claim depends on a specific study, the study is described rather than over-claimed.
Tesamorelin is a synthetic peptide that acts as an analog of growth hormone-releasing hormone, a natural hypothalamic signal. Its sequence corresponds to the forty-four amino acid form of the human hormone, with a small acyl group attached near the amino terminus. That modification slows enzymatic breakdown and extends the time the peptide remains active in circulation. The compound was developed as a pharmacological way to raise endogenous growth hormone output rather than supplying the hormone directly.
After injection, the peptide binds receptors on somatotroph cells in the anterior pituitary. Receptor activation raises intracellular cyclic AMP and triggers release of stored growth hormone into the bloodstream. Because the compound works through the body's own regulatory system, growth hormone pulses retain much of their normal feedback control. Repeated administration also raises insulin-like growth factor 1, a hormone produced mainly in the liver. Investigators treat that rise as a marker that the pituitary axis has been engaged.
Clinical study of tesamorelin has centered on adults with HIV-associated lipodystrophy, a condition in which abdominal fat accumulates while peripheral fat is lost. In controlled trials, treated participants showed reductions in visceral adipose tissue measured by imaging, alongside modest shifts in some lipid values. Effects on subcutaneous fat were smaller and less consistent across studies. Whether these changes translate into fewer cardiovascular events remains an open question, because the trials were not designed or powered to answer it.
Once reconstituted, the peptide is handled as a solution and is less stable than the lyophilized powder. Aqueous solutions are commonly kept cold and used within a defined period. Buffer composition and pH influence degradation rates, with extremes of acidity or alkalinity accelerating hydrolysis. Preservatives may be added in multi-dose formats to limit microbial growth. Freezing and thawing of solutions is generally avoided because it can cause precipitation or loss of activity.
Identity and purity are assessed by reversed-phase high-performance liquid chromatography, which separates the peptide from related impurities. Mass spectrometry, often coupled to liquid chromatography, confirms molecular mass and detects chemical modifications. Peptide mapping and amino acid analysis can verify sequence integrity. Water content is measured by Karl Fischer titration, and residual solvents may be checked by gas chromatography. These methods together support batch-to-batch consistency and routine quality control.
| Property | Value | Notes |
|---|---|---|
| Drug class | Peptide hormone analog | Acts at the growth hormone-releasing hormone receptor |
| Receptor | Growth hormone-releasing hormone receptor | G protein-coupled; raises cyclic AMP in somatotrophs |
| Key mediator | Insulin-like growth factor 1 | Increases with repeated administration |
| Main studied population | Adults with HIV-associated lipodystrophy | Trials measured visceral adipose tissue by imaging |
| Route | Subcutaneous injection | Given once daily in clinical use |
Tesamorelin occupies a narrow position among agents that act on the growth hormone axis. Unlike growth hormone itself, which is given as replacement, it stimulates the pituitary to release the hormone in pulses, so the downstream increase in insulin-like growth factor 1 depends on intact somatotroph function. Other peptides in the same family include shorter GHRH fragments and synthetic secretagogues with different stability profiles. Several points remain unresolved, including whether the reduction in visceral fat translates into fewer cardiovascular events, what happens to metabolic markers after long-term use, and how the drug compares with lifestyle or surgical approaches.
Tesamorelin is a synthetic peptide that belongs to the growth hormone-releasing hormone family and contains the same forty-four amino acid sequence as endogenous GHRH, extended at the amino terminus by a trans-3-hexenoyl group. That small fatty acid modification protects the peptide from rapid cleavage by dipeptidyl peptidase-4, the enzyme that shortens the half-life of native GHRH to only a few minutes. Chemically the compound is produced by solid-phase peptide synthesis, purified by chromatography, and supplied as a sterile lyophilized powder for reconstitution.
Regulatory approval in the United States came in 2010, when the Food and Drug Administration cleared the peptide for the reduction of excess abdominal fat in adults with HIV infection and associated lipodystrophy. The decision rested mainly on two randomized phase 3 trials that enrolled roughly eight hundred patients and ran for twenty-six weeks. Participants receiving active drug showed substantially greater declines in visceral adipose tissue than those receiving placebo, while total body weight changed comparatively little. A reformulated presentation was later approved, and the product has remained a niche therapy rather than a general weight-loss agent.
Pharmacodynamic studies show that tesamorelin reduces visceral adipose tissue more than subcutaneous adipose tissue in the studied population. This selectivity may relate to differences in blood flow and hormone sensitivity between fat depots. Effects on glucose metabolism and insulin sensitivity have been investigated, with some trials reporting modest changes and others showing stability. The precise relationship between growth hormone exposure, IGF-1 levels, and visceral fat loss remains an active area of analysis.
Tesamorelin binds to growth hormone-releasing hormone receptors on somatotroph cells in the anterior pituitary. Receptor activation increases intracellular cyclic AMP and promotes synthesis and secretion of growth hormone. Because the peptide mimics endogenous GHRH, it amplifies the normal pulsatile release of growth hormone rather than providing exogenous growth hormone directly. This upstream action distinguishes tesamorelin from recombinant growth hormone preparations and from growth hormone secretagogues that act at different receptors.
Binding of tesamorelin to GHRH receptors on pituitary somatotroph cells triggers cyclic AMP signaling and the release of growth hormone into circulation. Because the peptide acts upstream of the growth hormone axis, its effects are partly mediated by hepatic insulin-like growth factor 1 (IGF-1) production. The pulsatile character of endogenous growth hormone secretion is preserved rather than replaced. Whether amplified signaling produces effects beyond those of native GHRH remains an area of ongoing investigation.
A documented effect of tesamorelin is a reduction in visceral adipose tissue in some study populations. Researchers have reported decreases in trunk fat measured by computed tomography alongside changes in lipid markers. The mechanism is thought to involve growth hormone-mediated lipolysis, though the precise contribution of direct versus indirect pathways is not fully resolved. Studies have generally examined defined groups over finite periods, so long-term outcomes are less well characterized. Findings have not been uniform across all trials.
Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). Its sequence corresponds to the 44-amino-acid form of human GHRH with a trans-3-hexenoyl group attached to the N-terminal tyrosine. This modification slows enzymatic cleavage and extends the peptide's activity relative to the native hormone. The compound is produced by solid-phase peptide synthesis and supplied as a lyophilized powder. Researchers classify it as a GHRH receptor agonist. Its structure places it in the same family as other growth hormone secretagogues that act on the pituitary.
=== Reproduction and lifespan === Breeding season takes place between August and December. The coastal taipan is oviparous, laying a clutch of 7 to 20 eggs. The eggs take 60 to 80 days to hatch, with the newly hatched snakes ranging from 30 to 34 cm (12 to 13 in) in length. The young grow quickly, averaging 6.7 cm (2.6 in) a month, and reaching a length of 1.0 m (3.3 ft) in a year. Male coastal taipans reach sexual maturity when they reach 80 cm in length, which they reach around 16 months of age, while females are able to breed when they are around 100 cm long, around 28 months old.
Rules of competition law balance the interests of different groups, generally to favour consumers, for the larger purpose in the Treaty on European Union article 3(3) of a "highly competitive social market economy". The EU is bound by the Treaty on the Functioning of the European Union article 345 to "in no way prejudice the rules in Member States governing the system of property ownership". This means the EU is bound to be neutral to member state's choice to take enterprises into public ownership, or to privatise them. While there have been academic proposals for a European Civil Code, and projects to frame non-binding principles of contract and tort, harmonisation has only occurred for conflict of laws and intellectual property.
The current Lula government, which began in January 2023, faced its first crisis with the fall of the chief minister of the Institutional Security Office (GSI), General Gonçalves Dias. The crisis was triggered by the release of images of the invasion of the Presidential Palace that occurred on 8 January by CNN Brasil, which raised doubts about the performance of the agency during the coup attack. The images showed collaborative action by agents with coup plotters and the presence of General Gonçalves Dias at the scene. The relationship between president Lula and the general was longstanding, with Gonçalves Dias acting as the PT leader's security chief during his first two terms. The minister's fall was accepted by Lula after an emergency meeting at the Palácio do Planalto, where ministers assessed that the images were impactful and made it evident that the general's performance had been below what was expected for the security of the presidential palace.
The two substrates of this enzyme are 4-phospho-D-erythronic acid and oxidised nicotinamide adenine dinucleotide (NAD+). Its products are (R)-3-hydroxy-2-oxo-4-phosphonooxybutanoic acid, reduced NADH, and a proton. This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. The systematic name of this enzyme class is 4-phospho-D-erythronate:NAD+ 2-oxidoreductase. Other names in common use include PdxB, PdxB 4PE dehydrogenase, and 4-O-phosphoerythronate dehydrogenase. This enzyme participates in vitamin B6 metabolism.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Since the oxychlorides are asymmetrical, and they should have increasingly large electric dipole moments going down the group, they should become less volatile in the order TcO3Cl > ReO3Cl > BhO3Cl: this was experimentally confirmed in 2000 by measuring the enthalpies of adsorption of these three compounds. The values are for TcO3Cl and ReO3Cl are −51 kJ/mol and −61 kJ/mol respectively; the experimental value for BhO3Cl is −77.8 kJ/mol, very close to the theoretically expected value of −78.5 kJ/mol.
=== Use after MDMA === MDMA is an empathogenic-entactogenic and serotonergic psychotropic drug used primarily for recreational, though sometimes also therapeutic, purposes. Among users of MDMA, the serotonergic effects of the drug are often of particular interest and concern: After consuming MDMA, serotonin concentrations are greatly reduced in the brain. 5-HTP is necessary for serotonin production and its concentrations in the brain also decrease after taking MDMA.
Topography is the study of forms and features of land surfaces. The topography of an area may refer to landforms and features themselves, or a description or depiction in maps. Topography is a field of geoscience and planetary science, and is concerned with local detail in general, including not only relief, but also natural, artificial, and cultural features such as roads, land boundaries, and buildings. In the United States, topography often means specifically relief, even though the USGS topographic maps record not just elevation contours, but also roads, populated places, structures, land boundaries, and so on. Topography in a narrow sense involves the recording of relief or terrain, the three-dimensional quality of the surface, and the identification of specific landforms; this is also known as geomorphometry. In modern usage, this involves the generation of elevation data in digital form (DEM). It is often considered to include the graphic representation of the landform on a map by a variety of cartographic relief depiction techniques, including contour lines, hypsometric tints, and relief shading.
=== Breast cancer === Breast cell proliferation has been found to be significantly increased by the combination of an oral estrogen plus cyclic medroxyprogesterone acetate in postmenopausal women but not by the combination of transdermal estradiol plus oral progesterone. Studies of topical estradiol and progesterone applied to the breasts for 2 weeks have been found to result in highly pharmacological local levels of estradiol and progesterone. These studies have assessed breast proliferation markers and have found increased proliferation with estradiol alone, decreased proliferation with progesterone, and no change in proliferation with estradiol and progesterone combined. In the Postmenopausal Estrogen/Progestin Interventions (PEPI) trial, the combination of estrogen and cyclic oral progesterone resulted in a higher mammographic breast density than estrogen alone (3.1% vs. 0.9%) but a non-significantly lower breast density than the combination of estrogen and cyclic or continuous medroxyprogesterone acetate (3.1% vs. 4.4–4.6%). Higher breast density is a strong known risk factor for breast cancer. Other studies have had mixed findings however. A 2018 systematic review reported that breast density with an estrogen plus oral progesterone was significantly increased in three studies and unchanged in two studies. Changes in breast density with progesterone appear to be less than with the compared progestins.
Sources: en.wikipedia.org
Domodedovo—22 kilometers (14 mi) Vnukovo—11 kilometers (7 mi) Sheremetyevo—10 kilometers (6 mi) Ostafievo—about 8 kilometers (5.0 mi) A number of smaller airports are located near Moscow—19 in Moscow Oblast. An example is Myachkovo Airport. These airports are intended for private aircraft, helicopters, and charters.
=== Dried flour === In South-west Nigeria, unripe plantains are also dried and ground into flour which is referred to as Elubo Ogede. it is considered as a healthy and nutritious food among the Yoruba. In southern India, dried plantain powder is mixed with a little bit of fennel seed powder and boiled in milk or water to make baby food to feed babies until they are one year old.
Current medical guidelines recommend testing tissue transglutaminase 2 immunoglobulin A (TTG IgA) in those with suspected coeliac disease. Because IgA deficiency is more common in those with coeliac disease, guidelines recommend testing for IgA deficiency as a part of the diagnostic workup for coeliac disease. If an individual with IgA deficiency is getting tested for coeliac disease, immunoglobulin G (IgG) based tests such as deamidated gliadin peptide IgG (DGP IgG) or endomysial antibody (EMA) can be used instead of IgA-based tests. Antigliadin antibodies (AGA) and antireticulin antibodies (ARA) were historically used to test for coeliac disease; however, due to the development of more accurate tests, they are no longer recommended. Due to the risk of false positive or negative serological tests and the consequences of leaving coeliac disease untreated or introducing unnecessary dietary restrictions. In the case of a false positive, biopsies are used to confirm the diagnosis regardless of blood test results. TG2 IgA has a high sensitivity (92.8%) and specificity (97.9%), and is cost-efficient and widely available, making it the first choice for serological tests in the diagnosis of coeliac disease. Performance of the TG2 IgA test differs between labs and no formal standardisation between assays exists. The severity of small intestine damage generally correlates with the levels of TG2 IgA found in the blood, meaning that the sensitivity is lower in people who have less damage to their intestines.
A sarcoma is a rare type of cancer that arises from cells of mesenchymal origin, meaning that sarcomas are cancers of connective tissues such as bone, cartilage, muscle, fat, or vascular tissues. Sarcomas are one of five different types of cancer, classified by the cell type from which they originate. While there are five types under this category, sarcomas are most frequently contrasted with carcinomas which are much more common. Sarcomas are quite rare, making up about 1% of all adult cancer diagnoses and 15% of childhood cancer diagnoses. There are many subtypes of sarcoma, which are classified based on the specific tissue and type of cell from which the tumor originates. Common examples of sarcoma include liposarcoma, leiomyosarcoma, and osteosarcoma. Sarcomas are primary connective tissue tumors, meaning that they arise in connective tissues. This is in contrast to secondary (or "metastatic") connective tissue tumors, which occur when a cancer from elsewhere in the body (such as the lungs, breast tissue or prostate) spreads to the connective tissue. The word sarcoma is derived from the Greek σάρκωμα sarkōma 'fleshy excrescence or substance', itself from σάρξ sarx meaning 'flesh'.
Similarly, Sumo wrestlers are typically categorized by BMI as "severely obese" or "very severely obese", but one study of college-aged Sumo wrestlers found that 40% of them were no longer categorized as obese when body fat percentage (with a cutoff of <25%) was used instead of BMI; this was attributed to their very high lean body mass. The Edmonton Obesity Staging System (EOSS), developed in Canada, supplements BMI-based classification by incorporating medical, functional, and mental-health factors into a five-stage clinical framework.
Sources: en.wikipedia.org
It is a laboratory-made peptide that mimics growth hormone-releasing hormone. It prompts the pituitary gland to release growth hormone and has been studied mainly in adults with HIV-associated lipodystrophy.
Administered growth hormone supplies the hormone directly, while this peptide acts upstream by prompting the pituitary to release it. The indirect route preserves pulsatile secretion and some endogenous feedback, which changes the hormone and IGF-1 profile observed after treatment.
Reductions in visceral adipose tissue appear consistently in randomized trials of the approved population. Effects on peripheral fat, cardiovascular outcomes, and use outside that population are less well established.
Refrigeration between 2 and 8 degrees Celsius is typical, with protection from moisture and light. Dry, sealed containers help maintain stability over the labeled shelf life. Temperature cycling is usually minimized.